PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G119400.1.p
Common NameLOC101761379, SETIT_002632mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 257aa    MW: 26252.8 Da    PI: 7.7667
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G119400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.62.5e-44291281100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++l+
  Seita.5G119400.1.p  29 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHRLQ 119
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +el+++++e
  Seita.5G119400.1.p 120 KELDAAHAE 128
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3928129IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4329126IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MASPSSTSNN SALSPAASSG ATTPGAGAPC AACKFLRRKC LPGCVFAPYF PPEEPQKFAN  60
VHKVFGASNV TKLLNELLPH QREDAVSSLA YEAEARVKDP VYGCVGAISV LQRQVHRLQK  120
ELDAAHAELL RYACGDVSGI PTALPVSGGA APRLSAAMPS PGQFATSATA AAGMYSGRTR  180
LGLVDGIAPP PPPAGCYFMR SNNVVMSSSP GADVAPVLPY ASMANWAVNA MSATTTATSG  240
SESIVLDHKE GGDSSM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9516390.0JQ951639.1 Loudetia sp. MCE-2012 Ramosa2 (ra2) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968335.10.0PREDICTED: LOB domain-containing protein 4-like
TrEMBLK3XL590.0K3XL59_SETIT; Uncharacterized protein
STRINGSi002632m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.47e-63LBD family protein